SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8AXT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8AXT1
Domain Number 1 Region: 313-702
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.56e-98
Family Regulator of chromosome condensation RCC1 0.00066
Further Details:      
 
Domain Number 2 Region: 70-173
Classification Level Classification E-value
Superfamily PH domain-like 2.54e-25
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 3 Region: 701-770
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  B8AXT1
Domain Number - Region: 914-976
Classification Level Classification E-value
Superfamily Tropomyosin 0.0242
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8AXT1
Sequence length 1385
Comment (tr|B8AXT1|B8AXT1_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC79138.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_19792 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MSDASSDLAGARPGAVERDIEQVSRFPILRLARLGNAEEIPAVGVFLVSGPRVAGKASLD
GCMIELGVAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSR
IIPGQRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLITRSHQRK
WRTESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGGENYRLRSPFGSPPKVGLE
KAFSDIVSYAAPPKPFFPSDSNAGSVHSVSSGQSDNTNLHSRGIPMDAFRVSLSSAVSSS
SHGSGHDDGDALGDVFIWGEGTGEGILGGGNSRVGNSGVKMDCLIPKPLEFAVKLDVQNI
SCGGRHATLVTKQGEIYSWGEESGGRLGHGVDCDVPQPKLIDALANMNIELVACGEYHTC
AVTLSGDLYTWGNGTSNSGLLGHGNEVSHWVPKRVNGPLEGIHVSAISCGPWHTAIVTSA
GQLFTFGDGSFGVLGHGDRQSLSVPREVESLKGLRTVRAACGVWHTAAVVEVMVGNSSSS
NCSSGKIFTWGDGDKGRLGHGDKDTRLVPTCVAALVEPNFCQIACGHCMTVALTTSGHVY
TMGSPVYGQLGNPQADGMLPVRVEGKLHKNFVEEISCGAYHVAVLTSRTEVYTWGKGANG
RLGHGDTDDRSSPTLVESLKDKQVRTVVCGINFTAAICIHKWVSGVDQSMCSGCRLPFNL
RRKRHNCYNCALVFCHACSSKKSLKASLAPNPNKPYRVCDSCYSKLNKGPETDRYSSAKR
GSVIQGFNDSVDEELETKSNAQLSRLSSLESFKHMDSRTSKKNKKFEFNSSRVSPIPNGS
SHWSGLNISKSFGSSKKFFSASVPGSRIVSRATSPVSRRASPPRSTTPTPTLGGLTSPRV
VDGVKPNDSISQEVLSLRSQVENLTRKSQLLEADLERTTKQLKEAISIAGEETAKCKAAK
EVIKSLTAQLKGMAEKLPEGAGLVKNSRLPPLPGISIPTDISVASESLGSPRSSGEPCSN
GSNGLLVSNGPTSVRNKLSHPEIPKNGTRLPDSDSKHESEWVEQDEPGVYITLTALPGGT
RDLKRVRFRNLRLCPPFLETAGSVSARHKQNNGGKRIGHGLRCKVALKDLSFVLADLSAC
FGENFMPITLLPQIERHLSNLHGLDEHLAKGGGIPQQYPQEGYHAQNSSHCWPKIVVTVG
PKKPWAKISLGTPTTLPSWSVAQSETTIQTSVAHGLRHTRPTPLRQPASSPANDKTATTP
VTLASALTQATFTTPPAGFPVESDLWEPAQGTTLPRQSEFSLLTDHRLQSAKKLPTKKGR
SSLAGRPSPPSCLKAPHKEGEELPKHSGSLANHKEDDPVAKLTGGLADASAPLPPRSSPT
ATRAT
Download sequence
Identical sequences B8AXT1
OsIBCD017831 39946.BGIOSIBCE018861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]