SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8BEL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8BEL0
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.42e-20
Family Thioltransferase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8BEL0
Sequence length 109
Comment (tr|B8BEL0|B8BEL0_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC85066.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_32405 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MTIDSWQQLIDSLKGNVVVLEFMAPWSEPSKFMEQPFKEVASEFKDKNSNVKFAALNFDN
SKNLARRLQVEALPTFLVVNNFAVVDRILALSKTELQQKINDKLAQTNY
Download sequence
Identical sequences A0A0D3HA30 B8BEL0
OBART09G19710.1 39946.BGIOSIBCE030926 OsIBCD029409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]