SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8BJY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8BJY9
Domain Number 1 Region: 319-457
Classification Level Classification E-value
Superfamily ApaG-like 3.92e-28
Family ApaG-like 0.00034
Further Details:      
 
Domain Number 2 Region: 109-242
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000157
Family SMI1/KNR4-like 0.012
Further Details:      
 
Weak hits

Sequence:  B8BJY9
Domain Number - Region: 36-74
Classification Level Classification E-value
Superfamily F-box domain 0.000148
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8BJY9
Sequence length 457
Comment (tr|B8BJY9|B8BJY9_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC67975.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_35735 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAAPPQPQPEPEPAAGGAGLEALEGLALDTVIAKAGARQAAALACASTRLRDAAGDDALW
RRFCADDLALHAPLAPDGRALPSFKDAYKVWLESFGMYPLPLVRRVKIFWSSLKSWLSEN
FPEAHKTLNKGVSEAQIQSAEDDLGFKLPLPTKLLYRFCNGQLPLSEHHHENMRMAHLGI
IGGYVFYDHLINVHLSPLEQIVEETKEFYREFYDQGVFNMTNLIIVATSWYRPKTFFLNC
SDDQLYVGTINLQDGEMLPCVPKSLIRPTNTDMPQDGLLLWLEEHLRRLQNGMIKIRMLK
TSRYISLFPEASPSCTSAMTNGVKVRASAVFAPEHPESRRPGAKCLYAYSIRLSVPEACM
LGGVYYSSCQLYSRHWIIRWRDRVVSDVNGEGVIGKYPLLTTGQEEFVYESCTPLPDSPG
SVEGSFTFVPGKLSRPEGKPFEVTVAPFPLEIPEYIF
Download sequence
Identical sequences B8BJY9
39946.BGIOSIBCE034096 OsIBCD032362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]