SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8CQS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8CQS9
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.24e-36
Family SMI1/KNR4-like 0.00000869
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8CQS9
Sequence length 123
Comment (tr|B8CQS9|B8CQS9_SHEPW) Uncharacterized protein {ECO:0000313|EMBL:ACJ30545.1} KW=Complete proteome OX=225849 OS=Shewanella piezotolerans (strain WP3 / JCM 13877). GN=swp_3868 OC=Shewanellaceae; Shewanella.
Sequence
MSETVPVPLELATFEQIVEVEEEILIPLPLALKEYLMEASDVIVGSLEPVTASDPHSHTF
LPEVAAYAWSIGLPREFVPICQRGDAFFFISQEGEVKLWQDDEIEEDSWETFWEWAEDVW
MRS
Download sequence
Identical sequences B8CQS9
gi|212636607|ref|YP_002313132.1| 225849.swp_3868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]