SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8D095 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8D095
Domain Number 1 Region: 62-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-52
Family RecA protein-like (ATPase-domain) 0.029
Further Details:      
 
Domain Number 2 Region: 247-261,295-449
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.21e-42
Family ATP-dependent protease Lon (La), catalytic domain 0.002
Further Details:      
 
Weak hits

Sequence:  B8D095
Domain Number - Region: 6-30
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.068
Family RBP12 subunit of RNA polymerase II 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8D095
Sequence length 451
Comment (tr|B8D095|B8D095_HALOH) DNA repair protein RadA {ECO:0000256|HAMAP-Rule:MF_01498, ECO:0000256|RuleBase:RU003555} KW=Complete proteome; Reference proteome OX=373903 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562). GN=Hore_00880 OC=Halothermothrix.
Sequence
MPRPKTYYICSECGYKSAKWMGRCLNCGAWNTFQELDEEAIEEKVDIKVTPSSITDIKAG
ACPRLSSGIGEFDRVLGGGVVPGSLILLGGAPGIGKSTLVLQMARHFSEKYGKVLYVSGE
ESASQLKMRAGRLGAINEDLYVLSETNFQQIYGVIQNEKYELIIIDSIQTIFDPRIESTP
GSISQVKEVTNRLLIQAKKLEVPIVLIGHVTKEGHLAGPRVLEHLVDTVLQFEGDRNYIY
RILRAVKNRFGSTNEIGVFEMMGSGMREVVNPSEIFLKGRAQGVSGSVIVPVVEGSRPLL
VEVQALVTYSSFGTPQRLTTGVDRKRVSILLAVLEKKAGINFHNQDVNINITGGLKVEEP
ALDLGIITAILSSCKDQEVAPDLAVIGEVGLAGEIRAVSQIERRLSELKKMGFKEVVIPG
GNISGLDFDPDINIVEVKNVNDLMKILFNRR
Download sequence
Identical sequences B8D095
gi|220930936|ref|YP_002507844.1| WP_012635048.1.20074 373903.Hore_00880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]