SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GDM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GDM1
Domain Number 1 Region: 40-310
Classification Level Classification E-value
Superfamily NHL repeat 1.36e-52
Family NHL repeat 0.000018
Further Details:      
 
Domain Number 2 Region: 468-522
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000706
Family Type I dockerin domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8GDM1
Sequence length 522
Comment (tr|B8GDM1|B8GDM1_METPE) NHL repeat containing protein {ECO:0000313|EMBL:ACL17372.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_2074 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MKVFSLLCILLLLCGSVQAVTATETYLSSRLWGTPGFGINQFNSPEGIAVDGTGNVYVAD
MNNDRISFFTKASLPQMPSSIGRIGSGHGQFFYPHGVAVDSTGNVYVADTGNHQIQKFTV
NGNFNTQWGIKGSGTNQFNSPEGIAVDGAGNVYVADTGNNRIEKFTSSGDIVTSWGSYGS
EVGQFNRPTSVAVDNTGIGYIYVADTGNNRIQKFTLTGDLVATRSISNSGASQFNRPTSV
AVDTGGSVYVADTGNNRIQKFTSSGDLITSWGSYGSESGQFVSPCGITVDGEGTVYVADT
GNNRIQRFTPVQTYATLDFVPGTKTLVLGEHQSFDLTLSGIDTGLSGSEVIVSVANPSVL
DIVGASPPVWSSTPQYYDLPSSAVTIGGADLGNRVQGRMSNIPLGNLTVQGKLPGTTSLD
VTRYQLDDDSGNLVPVITMSVVITVSGTLIRSLPSSDTPPHDLDQDGLYEDVNGDGVFNF
NDVIQYFNQIDWISDNEPTVAFDFNRNGRVDFGDIVTLFNIL
Download sequence
Identical sequences B8GDM1
gi|219852663|ref|YP_002467095.1| WP_012618691.1.75456 521011.Mpal_2074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]