SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GE04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GE04
Domain Number 1 Region: 561-704
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-20
Family Family 6 carbohydrate binding module, CBM6 0.0025
Further Details:      
 
Domain Number 2 Region: 66-341
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.000000000000262
Family Fucose-specific lectin 0.01
Further Details:      
 
Domain Number 3 Region: 451-546
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000249
Family PKD domain 0.0026
Further Details:      
 
Domain Number 4 Region: 399-454
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000157
Family Type I dockerin domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8GE04
Sequence length 739
Comment (tr|B8GE04|B8GE04_METPE) Carbohydrate binding family 6 {ECO:0000313|EMBL:ACL17505.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_2209 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MRRPSFLSCWPPIFSPKVIVTVNRHIFLSILSAALLLVSLGIGPVSAQTWQNETVDSAGQ
VGFFTSLALDSAGNPRISYFDDTDGNLKYAWHDGLGWHNETVDSEGRVGWYTSLALDSAG
NPRISYSDWSNNDLKYAWHDDSGWHTETVDSEGYVGAYTSLALDSAGNPRISYSDLSNND
LKYAWHDDSGWHNETVDSKGTVGWYTSLALDSAGNPRISYLYEGTDDLKYAWHDGSGWHN
ETVDSEGYVGKCTSLALDGAGNPRISYFDNTNNDLKYAWHNDSGWHTETVDSAEWVGWYT
SLALDSNGNPRISYFDDTNDDLKYAYYDSAGWHTETVDSAGEVGLYTSLALDGAGNPRIS
YLDFTHGDLKYAWVGTPLSGVCIVPGGTALPADTDGDGLYDDVNGDGVFNFADVALYFNQ
MEWISDNEPVAAFDYNGNGRVDFGDVIWLFNYLDAPIVSPTPTSTVAAFTLNKTMGAAPL
AVQFTSSDQCDLLNWTIQLGKTPIETRSGMNLTYVFSTAGTYTVQLKASNSTTGVISSAE
NTVTVTGTSTITTEQPYPTQHNVPGRVEAEDYDQGGEGIGYSDTTTPNEGGVYRTDSVDI
ESLPGASGYDVGWIRAGEFLTYSVDTTEAGTFDIGFCVANPGSTKTVIVYVNGAPRTLTI
PATGSWITWQTATLTGVSMNAGRNLIKVDMDNAASFNFDYMEFVVDYIASPTTTTPTPTD
TTLTPTQSPTDTTPTPILT
Download sequence
Identical sequences B8GE04
WP_012618824.1.75456 521011.Mpal_2209 gi|219852796|ref|YP_002467228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]