SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GE77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GE77
Domain Number 1 Region: 59-108
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000275
Family Type I dockerin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8GE77
Sequence length 110
Comment (tr|B8GE77|B8GE77_METPE) Uncharacterized protein {ECO:0000313|EMBL:ACL17578.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_2292 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MGMHRFTHVDPQTIVVTDTTITSLSFGEILEGMLPERPAPVPPGTNTPGDLNHEGLYEDI
NSNSLLDFSDVVVFFNQMDWITENDPVSAFDFNKKSRIDFNDIVILYNEQ
Download sequence
Identical sequences B8GE77
WP_012618897.1.75456 gi|219852869|ref|YP_002467301.1| 521011.Mpal_2292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]