SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GEE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GEE8
Domain Number 1 Region: 439-543
Classification Level Classification E-value
Superfamily PKD domain 7.46e-25
Family PKD domain 0.00033
Further Details:      
 
Domain Number 2 Region: 625-710
Classification Level Classification E-value
Superfamily PKD domain 1.57e-22
Family PKD domain 0.00051
Further Details:      
 
Domain Number 3 Region: 706-785
Classification Level Classification E-value
Superfamily PKD domain 8.89e-22
Family PKD domain 0.001
Further Details:      
 
Domain Number 4 Region: 45-376
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.44e-19
Family Galacturonase 0.064
Further Details:      
 
Domain Number 5 Region: 547-628
Classification Level Classification E-value
Superfamily PKD domain 1.31e-18
Family PKD domain 0.0011
Further Details:      
 
Domain Number 6 Region: 815-869
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000108
Family Type I dockerin domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8GEE8
Sequence length 869
Comment (tr|B8GEE8|B8GEE8_METPE) PKD domain containing protein {ECO:0000313|EMBL:ACL17649.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_2368 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MKQISINPVKNHGIRSVGLILMLLLLVQGAAAASVLVAASDSSASARSAADYRCDGSSDQ
VQINQALDRLAGSGGVVNLAAGTFHCDNFIYVPGAITLTGQGEGGTTIEMINSGETDLPI
TVNSPEVSLSSFTLRGTGYIKITTSQVTVTDVAATNIGTNGHRYPAGGNGMFFIWADGTH
NIEDVSFINCRAVDCNTHGFNLNAKGTAPKETRNIRFINCQATRCGFGAESRDTDITGFD
LQEENDVYDIQLIGCIADDNWESGFHFEPGEDETPPTVKQGIVIRDCISRNNGQRNTLTY
PYHTFMSGFFVSRNAVLTNCKAINNRNAGFFVQGGRNIIFNDCTDDGSSYGWKIVKWSSG
VTLNDCTASDNKIWALWSAFADHITLNRFVQDNAGGLYGTQSMLGWYYGEPAYEQPVNDS
YFDITAYGNHALPIINFNGTGNIYYLRWGDWPGQNGTAPPPTSPAQPNASFIASPSTGFA
PLAVQFTDTTTGVPTDWYWDFGDGTTSSEQNPSHTYTQDGLWTVTLHVGNALGDASTQQT
VAIGTNPHAGFTTTDRRVIDAGGTIHFTDTSTGHPNSWLWDFGDLTTSTDENPIHRFLTA
GIFMVKLIATYGAGTDTEVKSSYITVYPVAQMGVDVSDGAAPMTVHFTDRSYGSPSSRLW
DFGDGSTSIEQNPVHIYPYGGTYTVTLTVEGINGGPIDRATATLSVTGAPSASFTATPAG
TTPPVTVTFLDRSIGQIDSRFWSFGDGTTSTEQSPVHTYSNAGTYNATLTTSNRWGSSST
TLQVNAGDPPYSPIQGVIALPGQSALPTDPNRERLYKDLNGDGAINFNDVVLYFNEMDWI
SDNEPVSAFDFNKNGKIDFDDIVFLFNLL
Download sequence
Identical sequences B8GEE8
521011.Mpal_2368 gi|219852940|ref|YP_002467372.1| WP_012618968.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]