SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GEN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GEN5
Domain Number 1 Region: 26-269
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.03e-41
Family Zn metallo-beta-lactamase 0.057
Further Details:      
 
Domain Number 2 Region: 371-478
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 1.31e-20
Family Lamin A/C globular tail domain 0.0045
Further Details:      
 
Weak hits

Sequence:  B8GEN5
Domain Number - Region: 304-358
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000353
Family Type I dockerin domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8GEN5
Sequence length 479
Comment (tr|B8GEN5|B8GEN5_METPE) Beta-lactamase domain protein {ECO:0000313|EMBL:ACL17736.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_2459 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MVDPLRYLLPILLLVLLIIPAAAHDPGTLTVSFLDVGQGDAILVQAPNDRAMLVDAGEAW
AGPTVSADLTAEGIARLDYLIASHDDDDHIGGISEVLRHVTIGEFVNNGLPADTETAAHL
WSLLADQGIPSLAATAGDTIPLDPANITVSVLNPPADRGTDQNEDSVVLRLIFGNQSFLL
TGDAGTEAEDRILAVGQPIASTYLKVGHHGSSTSTGTGFVNAVNPTVAIIEAGRFNLFHH
PNQAVVKRLQESGATVYTTAESGTVRVTATRTNSRLETTQGPELPITLPGFSLPPTDPDF
DGTFEDVDGNQQRDFADVVAYFNQMDWIEANEPVDRFDIDRNGQVDFGDVIRLFTIIDEP
IVTPTPTPSPTPTMTQEPDYTLVITGLDLANEWVSVQNTGEAPVDLTGCTLSDAGSTHVY
TFPSFTLAAGSTVTIHTGSGQTTGTDLFWGLGSSVWNNDGDTAALKRPSGTVISTLTRP
Download sequence
Identical sequences B8GEN5
521011.Mpal_2459 gi|219853027|ref|YP_002467459.1| WP_012619055.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]