SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GGU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GGU0
Domain Number 1 Region: 468-629
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-40
Family Histidine kinase 0.00064
Further Details:      
 
Domain Number 2 Region: 7-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-23
Family KaiB-like 0.00062
Further Details:      
 
Domain Number 3 Region: 397-478
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.02e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 
Domain Number 4 Region: 267-389
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000314
Family Flavin-binding PAS domain 0.041
Further Details:      
 
Domain Number 5 Region: 160-265
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000145
Family Heme-binding PAS domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8GGU0
Sequence length 640
Comment (tr|B8GGU0|B8GGU0_METPE) PAS/PAC sensor signal transduction histidine kinase {ECO:0000313|EMBL:ACL16345.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_0994 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MAPGIEMYLLRLYVAGETQESARAIQNLVRICETYLVGRYDLEVIDISRHPSLSRDEQIV
VTPTLIRKGPAPERRLIGDLSDTRVVLRGLGLPEGGLQNEPNDSGSSANPQVIKLCERLR
ETGVDRMDIWTGQVDGIVVPTSDEDRLFINPGGASPYWTFVETMNEGAVVIDRAGTILYC
NRRFAAIIEARMEMISGSFFDSWVCSHDHLLFEALSVAGADRQSSGDLQMVNTRGRLVPV
HLSLSPFTGGGVSEISIVVTDLTTRKHNCALLRSEHLAHSILEQAADPIVVINAEKVIIR
ANTAAVEMAGTNPLLAQFDSVFPLFQVIGDEEIPFSPSRISSAGKQLQGMEVLFRRTDRS
LFSLLISAAPIIGEFGESPGCVAVMTDITAQKQVEGELRRTLDDLAHSNQDLQQFAYIAS
HDLQEPLRMVASYLQLLERKYRDRLDSDAQEFIGFAVEGANRMQQQINDLLAYSRVTSRG
QPLKPVSAEEALASALSHLALKIEETGATVTHDPLPMVRADLPQLVQVFSNLLDNALTFL
RPQVAPVIHLSVEDQAGWVVFSLHDNGIGIDPEFYQRIFQMFQRLHSRAEYPGTGIGLAI
CQRIIERHHGRIWVTSVPGSGSTFSFTIPGVNGHLHGPDR
Download sequence
Identical sequences B8GGU0
WP_012617664.1.75456 521011.Mpal_0994 gi|219851636|ref|YP_002466068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]