SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GI10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GI10
Domain Number 1 Region: 22-249
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 8.83e-34
Family SGL-like 0.019
Further Details:      
 
Domain Number 2 Region: 287-387
Classification Level Classification E-value
Superfamily PKD domain 1.83e-27
Family PKD domain 0.00075
Further Details:      
 
Domain Number 3 Region: 390-472
Classification Level Classification E-value
Superfamily PKD domain 7.06e-25
Family PKD domain 0.00033
Further Details:      
 
Domain Number 4 Region: 475-558
Classification Level Classification E-value
Superfamily PKD domain 7.19e-24
Family PKD domain 0.00061
Further Details:      
 
Domain Number 5 Region: 565-644
Classification Level Classification E-value
Superfamily PKD domain 8.89e-24
Family PKD domain 0.00031
Further Details:      
 
Domain Number 6 Region: 643-727
Classification Level Classification E-value
Superfamily PKD domain 4.71e-18
Family PKD domain 0.0013
Further Details:      
 
Domain Number 7 Region: 850-930
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000641
Family PKD domain 0.0026
Further Details:      
 
Domain Number 8 Region: 732-811
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000314
Family PKD domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8GI10
Sequence length 930
Comment (tr|B8GI10|B8GI10_METPE) NHL repeat containing protein {ECO:0000313|EMBL:ACL16750.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_1421 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MKSSYSLYIICVLFLLCSSVQVVSAEGGYAYATQWGSSGSGDEQFSSPSGVAVDSVGNVY
VADVGNNRIQKFTSTGTFIKKWGSSGSGDGQFSSPSGVAVDSAGNVYVADTGNNRIQKFT
SMGIFIKQWGSSGSGNGQFFSSPFGVAVDNAGNVYVADTGNNRIQKFTSDGAFVTNWWVN
EPNGPDGVTVDSAGNVYVVDVSYIDRVQKFTSSGTFIAKFGSDYIHDSAMSYHTSVAVDN
AGNVYFRGPVSGIQKFSSTGAPITKWGNYGSGMYYGPGDVAVDSTGNVYVSDTQNAQIVK
FTPDIPLIPGFTATPTTGAAPLTVQFTDTTTGRPTSWYWNFGDGYASGAQNPSHLYSTAG
TYSVTLTATNAVSGSKSITKTGYITVTEAPAITPVADFTATPSNGAAPLAIQFTDRSTNA
KQWSWTFGDGTTSTEQHPSHTYTTAGTYTVVLTVRNAAGQSNTKTQTNLISVTSPVSETP
AADFTATPTSGTGPLTVRFTDTSTGVPTGWYWFFGDGYCAFEKNPSHIFAQAGTYTVQLY
TFNANGNSLKTKTDYITVSAVGGLNASFAATPTSGTAPLNVQFTDTSTGGATFWSWNFGD
GAASTDQSPSHTYSLAGTYTTSLTVRNSSGLTSIKEGTITVTAPQQTLQAAFTINTQTVI
AGQTTVTGIDTSTGSPATWYWDFGDGYASSARNINHVYTTAGSYTLSLTVTSGSQTSTTS
KTITVTGESVITPLANFTVTPQGGVGSMGILVLDTSVNVTSVLYDLGDGTTTTYSNFRYT
YWQPGTYTIKQTATSATGSSIKTITVTVPATNSPVSPTVTMTMTPTVSPTGTVSVTLTPT
PTDQPQTRAASFNVSPTSGKRSFTTALIDTTTGGNPVSWKWTCGNGQSFSGKSVGLNRIW
YNNAGTYTIILTVTDQDGSTRTATHTVTVL
Download sequence
Identical sequences B8GI10
gi|219852041|ref|YP_002466473.1| WP_012618069.1.75456 521011.Mpal_1421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]