SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GKC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GKC2
Domain Number 1 Region: 768-877
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-21
Family Family 6 carbohydrate binding module, CBM6 0.0026
Further Details:      
 
Domain Number 2 Region: 524-669
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000408
Family Family 6 carbohydrate binding module, CBM6 0.0056
Further Details:      
 
Domain Number 3 Region: 146-263
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000017
Family PKD domain 0.0016
Further Details:      
 
Domain Number 4 Region: 420-493
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000562
Family PKD domain 0.0011
Further Details:      
 
Domain Number 5 Region: 312-393
Classification Level Classification E-value
Superfamily PKD domain 0.000000196
Family PKD domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8GKC2
Sequence length 966
Comment (tr|B8GKC2|B8GKC2_METPE) Carbohydrate binding family 6 {ECO:0000313|EMBL:ACL15805.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_0431 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MNILSRTEIRRSALLLALILLSGCLLIPGAFAVTVSTGTYQIDAVGNTTTIPIMMDQAPN
GFAYYKIQISLTNPDVATITDCSFPTWLGLNLNTALPDKSVVIRGGDLTKAHVKAGDTNI
LLATLTVQGTAVGTTPITVTVSPPTYVVQDKDVVNYAVTTPAGQLTVGTPVTPTPTVQPP
VADFSVDTTNGTAPMTVHITDKSVNATTIKYSLGDGTSTGSLSPGGVTPYTYVAAGTFTL
TQTATNAAGSTNKTVTITVLGAPTTTPTVTPTTPTVTPTTPTVTPTTPTVTPTTPTVTPT
PTVTVTPGTLIADFQVATTPGSNLVKITDKSTNASTIRYNLGDGVSTKNMPPNGPVLSYY
YITANTYTITQTAVSATGQTATKQVTVTVGGAPTITTTTTTTTTATTTVTPTVTVTPGYP
VPDFALTTPSSMGIQIVDNSVNATSVKYDLGDGTTTKLTQFRYTYWQAGTYTITLTATNA
MGSSVKTVQVTVPATVPTTTTPTPTVTVTSTVTATPSGQQPYNGPHNAPGKVEAEDYDLG
GNNVAYYDTTSGNAGGLYRHDDVDIEIEDGPSGYDVGYIIGGEYLTYSVDAAADGDYPIT
LKVANPDAAAKTVTVSTGGASTSVSISSTGSFDTYNSFNSAGTLHLEQGRNIVKVDFGAS
RMNFDYFTIGTGSQPTTTVTTTATTAQPTTTVTTTATTAQPTVTTTATTTQPTTTTVQPT
GTPLSTPYYMISMVPGHIESYSYDNGGEGVAYHDTTTANLGGKLRSDGVDIEYSQSDAGY
NIGYVAAGEWLIYSVQIDTAGTYTAAIRASNPDSTDKHIVLSLEGSSTPLATVTVPPTGS
FDTYQTITTTVQLPAGRHWLKLSFPESRVNLRFMDITRGASTGPIAATGTPTLLVSTTPV
ETIVPTTPASVIDSITTATPLVTISPVITTPVITTPVITTPVITTPVITQAAVITPEAEN
NTSVKV
Download sequence
Identical sequences B8GKC2
521011.Mpal_0431 gi|219851096|ref|YP_002465528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]