SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GKT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8GKT0
Domain Number - Region: 8-41
Classification Level Classification E-value
Superfamily PKD domain 0.000445
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8GKT0
Sequence length 60
Comment (tr|B8GKT0|B8GKT0_METPE) Uncharacterized protein {ECO:0000313|EMBL:ACL17226.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_1922 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MGRPRLNRNLVHVYDVAGRYAISLSAIGSNRARTKTIEQYLNAALVTLPATATHPVPPIG
Download sequence
Identical sequences B8GKT0
gi|219852517|ref|YP_002466949.1| 521011.Mpal_1922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]