SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8HG67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8HG67
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-44
Family Ribonuclease PH domain 1-like 0.000000497
Further Details:      
 
Domain Number 2 Region: 325-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-43
Family Ribonuclease PH domain 1-like 0.000000426
Further Details:      
 
Domain Number 3 Region: 153-265
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.11e-24
Family Ribonuclease PH domain 2-like 0.00000639
Further Details:      
 
Domain Number 4 Region: 480-578
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.36e-22
Family Ribonuclease PH domain 2-like 0.0000137
Further Details:      
 
Domain Number 5 Region: 269-350
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.85e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00023
Further Details:      
 
Domain Number 6 Region: 587-673
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.06e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 7 Region: 653-726
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000315
Family Cold shock DNA-binding domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8HG67
Sequence length 752
Comment (sp|B8HG67|PNP_PSECP) Polynucleotide phosphorylase {ECO:0000255|HAMAP-Rule:MF_01595} KW=Complete proteome OX=452863 OS=chlorophenolicus). GN=Achl_1439; OC=Pseudarthrobacter.
Sequence
MEGPEIQFSEAVIDNGRFGKRVIRFETGRLAKQAAGAAMVYIDEDTALLSATTAGKHPRE
GFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTEAILACRLMDRPLRPAFVKGLRNEVQ
IVVTVLAINPDELYDVVAINASSMSTQLSGLPFSGPIGGVRVALVADENGSQWVAFPKHS
QLENSVFNMVVAGRVAGDDVAIMMVEAEATDNSWNLIKEQGATAPTEEVVSEGLEAAKPF
IKALCDAQADLAARAAKPTVEFPVFLDYQDDVYAAVEAAAADKLAAVFQIADKQERDTAS
DALKDEVTSSLAGQFEGREKELSAAFRSVTKHVVRQRILKDQIRIDGRGLTDIRQLTAEV
EVLPRVHGSAIFERGETQIMGVTTLNMLKMEQQIDSLSPVTRKRYMHNYNFPPYSTGETG
RVGSPKRREIGHGALAERALVPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLSML
NAGVPLKAAVAGIAMGLVSDQVDGQTRYAALTDILGAEDAFGDMDFKVAGTSEFVTAIQL
DTKLDGIPASVLAAALKQAREARLHILEVINSAIDTPDELSEFAPRVIAVKIPVDKIGEV
IGPKGKMINQIQEDTGADISIEDDGTVYIGATNGPSADAARSAINAIANPQVPEIGERYL
GTVVKTTTFGAFVSLTPGKDGLLHISELRKLANGKRVDNVDDVVSVGQKVQVEITKIDDR
GKLSLSPVVAEEEGAEGAERAHATEPAEGAEI
Download sequence
Identical sequences B8HG67
452863.Achl_1439 gi|220912209|ref|YP_002487518.1| WP_015936652.1.59127 WP_015936652.1.81542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]