SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8HZW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8HZW0
Domain Number 1 Region: 29-95
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.1e-17
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8HZW0
Sequence length 621
Comment (tr|B8HZW0|B8HZW0_CLOCE) Spore coat protein CotH {ECO:0000313|EMBL:ACL75460.1} KW=Complete proteome; Reference proteome OX=394503 OS=H10). GN=Ccel_1101 OC=Ruminiclostridium.
Sequence
MKKSRLLLLLSAIALVTCLFSMSFVGAATVYGDLNSDSSVDSIDYSIMKGYLFGSVTISN
PAAADVNGDGNIDAIDLALMKQYILHIITKFPADNNTTPGDNTPAAQLTGDIVFSAPSGT
FSNQVSVSLNSKIAGAQIRYTVDGSVPTASSPAYTSPLSFTRTTQLRAQSFVNGTPSGKM
GTAIYVSSAIDTKHDLPVLILDAYGGGKPAREYKDVAIMLMEPKNNEVSLLQTPTVATRA
GFHVRGQSSANFEKTPYRLELWDNQNEDAKYSLLGMPGDGDWALLSPFPDKSLIRNALAY
ELGTTMGLKAPRYRFVEVYLNLDNQPLSSADYQGVYLLTETLEIDKDRVNIKKLKDDDLT
EPNITGGYLMQFNMMATDGPLVKGSGWNDLEIKDPDDLLPQQLTWISNYIQKVHNSIRST
NPSDPTTGYPAYIDVDSFINYIIENELAREGDSYMRSTYIYKDRGAKLAAGPVWDYDLGY
NCVTGMMGMQTNYVEGWQFQPMFGMSSTCDWYYKLMQDSAFQSKISARWQELRNGPLSDT
QIKALVQKLTTPLANGAKRNFQKWNNLGTATVGGFSTQTTQTWEEQVTILQNFLLQRAAW
LDKSGWKPTTNTNPGWPGWGG
Download sequence
Identical sequences B8HZW0
394503.Ccel_1101 WP_015924616.1.84728 gi|220928531|ref|YP_002505440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]