SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8I0M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8I0M6
Domain Number 1 Region: 19-339
Classification Level Classification E-value
Superfamily Family 10 polysaccharide lyase 8.24e-89
Family Family 10 polysaccharide lyase 0.00000176
Further Details:      
 
Domain Number 2 Region: 493-548
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000222
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8I0M6
Sequence length 552
Comment (tr|B8I0M6|B8I0M6_CLOCE) Pectate lyase {ECO:0000313|EMBL:ACL75601.1} KW=Complete proteome; Reference proteome OX=394503 OS=H10). GN=Ccel_1245 OC=Ruminiclostridium.
Sequence
MITKTRSQIPKVLLITMLVSVFSLILLFPKHAFASTPDWKSVLKNSDSWFGSSEGIALAD
SIVKYQLADGGWRKDMTTSTSGSWGKSTIDNDTTTSQIKVLAKTYNQTKNTKYLTSCQKG
IDLLLNGQYSNGGWPQVFNDAGTYHAHITYNDNAMIHVMNLLTDVSKKSGDYTFIDSTRA
SKAGGAVQKGIQCILNTQIIVNGIKTAWCQQHDELTLKPTSGRAYELPSICTSESVGIVN
YLKGISNPSTEITNAINSAVNWFAQVKILGIKVVDTGDDRIVVSDSQAPPIWARFYEMGT
NRAMFVDRDGSIHYQMSEISQERRDGYDWYGDWPKNLVKDTVIPTPIPDGQYIKSLIVSD
TDNAADWSIQTNLQVGDTIYGDRTFKVVQIPQSLAGAEWIRTACDSKLYTSDEASFTAKS
DITVYAALDTRVTSIPAWFGSWTKTDETLSTDNAVTYNIYKKDFTTGSSVVLGTNGASSS
VVNYTVMVKPKSIILKGDVNGDGAVDALDFALVKRYLLNGVTDGMNLQAADMNNDNSVNA
IDLALIRGDILY
Download sequence
Identical sequences B8I0M6
394503.Ccel_1245 WP_015924750.1.84728 gi|220928672|ref|YP_002505581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]