SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8I434 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8I434
Domain Number 1 Region: 113-423
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.11e-84
Family beta-glycanases 0.00000466
Further Details:      
 
Domain Number 2 Region: 39-109
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.59e-17
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8I434
Sequence length 425
Comment (tr|B8I434|B8I434_CLOCE) Arabinogalactan endo-beta-1,4-galactanase {ECO:0000256|RuleBase:RU361192} KW=Complete proteome; Reference proteome OX=394503 OS=H10). GN=Ccel_2123 OC=Ruminiclostridium.
Sequence
MKGSKNKKLIVISLLILILVFENLILHINNYTVSAAAPQLLYGDVDVSGEVNSLDYALIK
SYLLGNITDFPDVNGKKAADVNGDGSIDSLDISLIKSFILGIIERFPIETPANTFAKGAD
ISWLPQMEASGYKFYNNKGLQQDCLQILKDYGVNSVRIRTWVNPSTDKWNGHCSTNETIA
LAKRAKNLGFRIMIDFHYSDSWADPGKQTKPAAWLNLDFNGLMKMTYDYTYDVMTKLRNN
GILPEWVQVGNETNNGMLWEDGKASNNMKNFAWLVNCGYDAVKAVNPKTKVIVHISNGFN
NTLFRWMFDGLNSNGAKYDVIGMSLYPDKDNYPALLNQCLNNMNDMVSRYNKEIMICEIG
MQYNYASESKAFIIDMVNKTKSLPNNKGLGVFYWEPESYPGMNGYNKGCWNSDGKPTIAL
DGFLN
Download sequence
Identical sequences B8I434
gi|220929538|ref|YP_002506447.1| WP_015925567.1.84728 394503.Ccel_2123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]