SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8I6V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8I6V7
Domain Number 1 Region: 312-753
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 7.18e-99
Family Cellulases catalytic domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 35-225
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.19e-51
Family Family 30 carbohydrate binding module, CBM30 (PKD repeat) 0.00000196
Further Details:      
 
Domain Number 3 Region: 200-311
Classification Level Classification E-value
Superfamily E set domains 2.24e-16
Family E-set domains of sugar-utilizing enzymes 0.0036
Further Details:      
 
Domain Number 4 Region: 762-824
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000422
Family Type I dockerin domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8I6V7
Sequence length 833
Comment (tr|B8I6V7|B8I6V7_CLOCE) Glucanase {ECO:0000256|RuleBase:RU361166} KW=Complete proteome; Reference proteome OX=394503 OS=H10). GN=Ccel_2621 OC=Ruminiclostridium.
Sequence
MKRKKLLALILSVAIVCTSLITSMSVINATAPEGWRNLQDFYVFKDKVNGWSGSGAGELE
TENGNLPVDTQVTYENLPSLRFNLSKELTSYWMSVVLVMAEWACHDVSQYVANGYLEFNV
KGNVGGEQFVIGAVDHVSERASGVEHTIAKPITDYCTVTTEWQHVKIPLKDILDPSLGMD
PYNAKAIVLDKVDLNPFCVWINQLKITSPDKERAYPAIKVNQVGFGESSEKYAYVSGFED
ELKAEAGTQFQVKRVSDDQVVYSDELVLVKDYDAESGERVFKAVFSDLKQPGEYYITVNE
DGIEKSPRFKIGNDIFKPLLTDVARYFYFQRSGTDLTEEYCPDYPRKDRTPQDTAAIYDS
NPSATRDVSQGWFDAGDLGKYVSTGAMAAINILWSYEMFPEVYTDNQFTIPESGNGIPDI
LDETKWQLDWILKMQDTSSGGFYARVQSDDDGNITKRIIKDKEGDVANIRSTEDTACAAA
ALAHASIVYEKYDPAFALKCLNAAKSAWSYLEKNPSNIKSPDGPYSTADDSQSRFLAAAT
LYRVTGEAKYNDYFLENYSKGKNSYENVSGDWVGSWNFAFFSYMKANNRNGDAEKWFKDE
FTIWLNNKIDRYKNNTWGNTIANGNYYWGSNSQILGMCMEALIGSKVLGISNDEINKMTF
SSFNWLLGANAMRKSFVSGYGDDCIKTIFSTFNNDGKSGIPKGFMPGGINRYQGVGLSLF
PSKCYLDSADEWSTNEHTTGWNSILTFVAAFANSNLSGENSIKTGDINGDGDINAIDLAM
LKKGILNEETFTGDALKAADINGDNEVNAIDFAQLKKLLLTIYNAPQCQDKHF
Download sequence
Identical sequences B8I6V7
394503.Ccel_2621 gi|220930020|ref|YP_002506929.1| WP_015926035.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]