SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8I8J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8I8J0
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 6.02e-19
Family N-utilization substance G protein NusG, N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 122-173
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000261
Family N-utilization substance G protein NusG, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8I8J0
Sequence length 173
Comment (tr|B8I8J0|B8I8J0_CLOCE) NusG antitermination factor {ECO:0000313|EMBL:ACL75223.1} KW=Complete proteome; Reference proteome OX=394503 OS=H10). GN=Ccel_0849 OC=Ruminiclostridium.
Sequence
MYWYVLFVRTGREENVKKLLSKRLDKDLFLPFVPLNERIFKKAGTVNKNMEILFPGYVFI
ESKVASQEFVKMTNELMKSLQDIIRLVRYSDIEIAVRESERIILQSLYNNNNCIESSSGI
IKGDKIYIIDGPLRGRESIVRHINRHKREAKIEIEFMGNIRLVSVSLEIVQKL
Download sequence
Identical sequences B8I8J0
WP_015924383.1.84728 394503.Ccel_0849 gi|220928294|ref|YP_002505203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]