SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8NPB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8NPB0
Domain Number 1 Region: 68-225
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 7.72e-21
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00038
Further Details:      
 
Domain Number 2 Region: 378-389,432-544
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000111
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8NPB0
Sequence length 627
Comment (tr|B8NPB0|B8NPB0_ASPFN) Phosphopentothenoylcysteine decarboxylase, putative {ECO:0000313|EMBL:EED48670.1} KW=Complete proteome; Reference proteome OX=332952 OS=12722 / SRRC 167). GN=AFLA_128930 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MTVDLRADHSFSAVSSTVANAPWPTEMEVDGGGEKVVENKERSAITSHELPNNDVASPAR
RRKRLLLSTESAFVDNVLSSLVQHPDIELRLITDEPSALLSGANKVPHYMDTVDSQTFEK
KTGARRWLKAKAAELCEWADMLLVAPIDAGTLGSMLYGLTNTLTLALLRGWISSKPVVLI
PGMTVSEWHHPLNARQLQEVDQHWPWVSVITPVLMKSNNPEELVQLPWGGLVELHETIES
TLGLSFSHSSTESIQSSEASKVSSGEQASLSTTATTSRHPPHRSDKGARSLPMELWLNIF
EDHLRDWEIAKAVGIPTNLSVPKEWQSHLLKMSAPASLEYTILRGSFAAIKKRIDSLPRW
KPISDLACHLIFKFSRTDILSYLTENHLDLLWTTSRLTNVPYRASAIYGNPNILTWWRDA
PALPTKEYIADAMDGASRAGFVNVLEWWRTSGLELRYTERALESASAEGRVSVLDWWKKA
SANAPPSDPIPLKVGKSVLLAAQSGRTASLAWWDASGIPYSHAESVARIASTHGHVHVLD
FWYRLKGAKMIFDSQVLVGPTKNGHDNVLEWWRQSGLRVEFKTCDIEEALEDADPVSGAE
ERVRRWWARNGLNLGVGTSEWMKTKVL
Download sequence
Identical sequences B8NPB0
AFL2T_09233 XP_002382086.1.25037 5059.CADAFLAP00009951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]