SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8P004 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8P004
Domain Number - Region: 35-70
Classification Level Classification E-value
Superfamily RING/U-box 0.0271
Family U-box 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8P004
Sequence length 312
Comment (tr|B8P004|B8P004_POSPM) Predicted protein {ECO:0000313|EMBL:EED85710.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_88219 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MGNDGGSIPDRRDLVRTKAKAEQADKANQTRARWFFCALSKRPLQEPIISCALGKLYNKD
SILEYLLDKSAYGDGEEICGHIRSLKDVKTLKLTHNTSKIVASDSTDLAAFVCPLNFKEM
NGSQPFMYIATCGCVFSLAGYNAVSGNTSPSAKEGKLEAEGKEHDNGQNTKQLDVCPQCA
TKYDRSADVMTLNPGPEEEATMYEAMMRKRAAEPAKTKGKKRKAHADAVDGETPPTKKRV
SPTPAMNPALAAASKAVATSLAREEIKRKANMSDAVRSLYASKDGPKKKETFMTMGTFTR
VRLILCFSRDHH
Download sequence
Identical sequences B8P004
jgi|Pospl1|88219|fgenesh3_pm.3__3 104341.JGI88219 XP_002469005.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]