SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8PAT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8PAT0
Domain Number 1 Region: 398-448
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000247
Family Erythroid transcription factor GATA-1 0.0045
Further Details:      
 
Domain Number 2 Region: 461-512
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000138
Family Erythroid transcription factor GATA-1 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8PAT0
Sequence length 759
Comment (tr|B8PAT0|B8PAT0_POSPM) Hypothetical transcription factor {ECO:0000313|EMBL:EED82006.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_90448 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MPSILNLKFKGNKSFVPFSNLGDVCTKVASFLEQGQRLENLSWRLWHLQNLMVDTDNAKS
KRDFKKLSKCMGDKLDKEKGRSIEELQAPGFKRNHSTELIQQRAAEKERERLANQNGRPG
TIHRMQFTFSVDQPAPPTASAAPVKKPDLKPSAEFKDNALKRGRPAARAAAHDDTRTTTT
TSGYTDDIYQNAALRFPSLFSNDFGPAALLYPTPTLTTPMTYGEGVGLGTHSSSDGFSIP
RPTIELPLDELLNADSPGGWAIGFMNAGHDGRSLEQQAQEDVEMKPEREMSLDTSISSRG
QSSEDDEALLTSTAALRNVPPLSTPIEDMVPRTITPTRLGGSNMQNNGDALGHGRGSSKR
PSLSVRTQSVSTRSSGPSATPVNGASSTAQNNNNSAPGGVKAECSNCGATHTPLWRRGLN
DELNCNACGLYCKLHKRPRPKSMRNNHGEGRTQSAPRQESQEVVAQCYNCHTTATPLWRK
DDEGKTVCNAYKLHGSARPISMKSDVIRKRARHDARRAGNGPSETPSASPGASRRASPTM
DATPTLAPDSTTQMYNNVNGDEMEYRTSMQSELMGALGGSQNGPYSGQNYNFNSYSAFPG
PYHPDYLSQMYNPPADALPFASGDLSDVDNSGGETRTNKRRRLSNDSASEPPSSAVSFSS
YSDSFTSASSSTSQSQRSSMDFAYNPYGSYGILRGNSINNAMWHPPMLPPDSTNSPHSSR
RSSHQTCFCIRKDSTTTTRSLCSRPTCTRLCFLLTIRLR
Download sequence
Identical sequences B8PAT0
jgi|Pospl1|90448|fgenesh3_pm.64__2 104341.JGI90448 XP_002472809.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]