SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8PBL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8PBL2
Domain Number 1 Region: 105-228,328-347
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-19
Family SPRY domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8PBL2
Sequence length 459
Comment (tr|B8PBL2|B8PBL2_POSPM) Predicted protein {ECO:0000313|EMBL:EED81707.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_18808 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
RKRKHAAISSTVASSPAPSDPGATPTPGAENVVLTSRHTDLSTRPRLDISRHPVFVPLYP
GSSYFSTEPLCNNRLNFRYTPAGLTPVGSLVPFRTIETVPTCSRVSWEDRSPFVRVTQDG
LGLKGEKGFRSARCNAPIREGKWYMEVKVEIGGGEKAPDCQLREGSHIRLGWGRREAPLN
APAGLDGYSYAYRDMTGEKVHLSRLRPYGKSFKSGDVIGMYISLPLPRRQPDRKDPYDPA
RIKRERIAIEFKGQEYFESLEYPQSKEMIALMDARDRAKATNSSSMPSSATKKAATVKNL
PSASRRKSTVQEPAPLRPLPTLGPDSHIAFFVNGECQGVAFRDLFDYLPLRNPQNKQQEK
KRSNKEGLREHKENSFDDGTLGYYPFISLFNGARVRINPGPDFEFTPPPDIDAVLSSSDA
HDADVKPHEAMRTWRPMCERYPEFMAEQWTMDEVEFAEA
Download sequence
Identical sequences B8PBL2
XP_002473061.1.31404 104341.JGI18808 jgi|Pospl1|18808|gw1.71.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]