SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8PCF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8PCF9
Domain Number 1 Region: 476-516
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000132
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 2 Region: 352-405
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000174
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  B8PCF9
Domain Number - Region: 93-139
Classification Level Classification E-value
Superfamily DHH phosphoesterases 0.0262
Family Exonuclease RecJ 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8PCF9
Sequence length 542
Comment (tr|B8PCF9|B8PCF9_POSPM) RING-type E3 ubiquitin transferase {ECO:0000256|SAAS:SAAS00970528} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_102843 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MNCARIIFELERTGSKNAEFILHLDVDEIHKVPIFRKTLKMITSDFAQSGIEQFKNVLGR
LQDVATKGRSAACAIITRPPEIIACFMIPTEGNGIFVIFDSHPRPNKHPHGAAFILNNSL
SATASYIADLLKYDDRLLSDSTLQWQAQLLAHFSAHIFTSSPTSGSAAELTEATLQASLE
VLSLRARVLDIESQNGYLTADNERLSGEVSRLEDEVAELKAQSQTQIFVQDKSYRNVSRT
FDVARDSQSQKGKGREVYVPHTSTNEVDSKQFIPPRRQIEGSHASSSRRAGSAFYDPMYD
HDFALAAALQAEQMPSQDGAYAASMQREFDGEDARLKAQMTTLKHTAPGIFECGICLEEF
NVDVVARIDICGHQFCRTCILGHTAAKIDERRYPIVCPICMADKGLKKQGDKQYEVFVEM
QLAAFSVILHCRKCKNTVFVDKSEHAATEILKIEFGGPKHSCDGSSELKHLMQQRGWKYC
PGCKTPAEKIDGCNHMTCMSPGCNTHFCYVCGEAITQSALRSEIKSALSAHYRRCRLFED
VA
Download sequence
Identical sequences B8PCF9
jgi|Pospl1|102843|fgenesh3_pg.79__47 104341.JGI102843 XP_002473353.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]