SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8PG50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8PG50
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.33e-21
Family Ribosomal protein L24e 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8PG50
Sequence length 111
Comment (tr|B8PG50|B8PG50_POSPM) Predicted protein {ECO:0000313|EMBL:EED80151.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_42152 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MRIDKCYFCSKSVYPGHGTAFVRNDAKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAG
KEMTIDSTIEFEKRRNVPVRYDRELVQTTVKAMKRISEIKQRREHAFWKNR
Download sequence
Identical sequences B8PG50
jgi|Pospl1|42152|gw1.121.120.1 XP_002474663.1.31404 104341.JGI42152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]