SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8PP11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8PP11
Domain Number 1 Region: 319-359
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000083
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 2 Region: 192-245
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000546
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8PP11
Sequence length 385
Comment (tr|B8PP11|B8PP11_POSPM) RING-type E3 ubiquitin transferase {ECO:0000256|SAAS:SAAS00970528} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_91254 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MAGAVTSTLLRPYLHILSYLGLEVLSLRARVLDIESQNGYLTADNERLSGEVSRLEDEVA
ELKAQSQTQIFVQDKSYRNVSRTFDVARDSQSQKGKGREVYVPHTSTNEVDSKQFIPPRR
QIEGSHASSSRRAGSAFYDPMYDHDFALAAALQAEQMPSQDGAYAASMQREFDGEDARLK
AQMTTLKHTAPGIFECGICLEEFNVDVVARIDICGHQFCRTCILGHTAAKIDERRYPIVC
PICMADKGLKKQGDKQYEVFVEMQLAAFSVILHCRKCKNTVFVDKSEHAATEILKIEFGG
PKHSCDGSSELKHLMQQRGWKYCPGCKTPAEKIDGCNHMTCMSPGCNTHFCYVCGEAITQ
SALRSEIKSALSAHYRRCRLFEDVA
Download sequence
Identical sequences B8PP11
104341.JGI91254 jgi|Pospl1|91254|fgenesh3_pg.558__1 XP_002477417.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]