SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8PPA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8PPA9
Domain Number 1 Region: 203-258
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000801
Family RING finger domain, C3HC4 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8PPA9
Sequence length 305
Comment (tr|B8PPA9|B8PPA9_POSPM) Predicted protein {ECO:0000313|EMBL:EED77288.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_96936 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MHFSKTYQQLLLTLPVELRDSAIEYRKLKKLINKVVNELNSIGLSPDVLQEVLGQGDIST
TRTIRVNDHEVKVIYELSNVADHIEPRLRLIGSQEALGSPSSPRSASLPGALDAATDEES
IAVTLPPGEGAGEDSTAVSVEEIITPSALSSLLQENVAPDTHEIIIPLVSDTAFYQLLTQ
ALQYLNAKLAVAIGENLLPIIPHIDDYACLICTNIAFKPIRLSCGHLFCVRCLVKMQKRG
QGHCPMCRAPNVLSADRSNVDWALLNFMQDWFPVESKQKLRQNEKEVAEEEWEELGIEVG
NCVVM
Download sequence
Identical sequences B8PPA9
104341.JGI96936 jgi|Pospl1|96936|fgenesh3_pg.712__2 XP_002477514.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]