SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8R2V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8R2V9
Domain Number 1 Region: 1-220
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-57
Family Duffy binding domain 0.0000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8R2V9
Sequence length 225
Comment (tr|B8R2V9|B8R2V9_PLAVI) Duffy binding protein {ECO:0000313|EMBL:ACJ01751.1} OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=dbp OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
CMKELTNLVNNTDTNFHSDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRW
SLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTGKNAQQHRKQWWNETKAQIWRAMMYSV
KKRLKGNFIWICKINVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKK
VCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAG
Download sequence
Identical sequences B8R2V9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]