SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8RII5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8RII5
Domain Number 1 Region: 38-105
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000662
Family Haloperoxidase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8RII5
Sequence length 107
Comment (tr|B8RII5|B8RII5_PINCO) Putative epoxide hydrolase {ECO:0000313|EMBL:ACL51728.1} OX=3339 OS=Pinus contorta (Shore pine) (Lodgepole pine). GN=eph OC=Spermatophyta; Pinidae; Pinales; Pinaceae; Pinus; Pinus.
Sequence
LQMYSSLYEKSGFVFPMQVPYLCSKRDPGRLTPFSDCTIQAPCLLIMGTKDYFLKFPGVE
YYVNSEMFKSAVPNIEIKFFPEGSHFVQEQFPKEVNKLLLGFLNQHL
Download sequence
Identical sequences B8RII5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]