SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9DV03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9DV03
Domain Number 1 Region: 10-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-41
Family Beta-D-xylosidase C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9DV03
Sequence length 210
Comment (tr|B9DV03|B9DV03_STRU0) Uncharacterized protein {ECO:0000313|EMBL:CAR42912.1} KW=Complete proteome; Reference proteome OX=218495 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J). GN=SUB1344 OC=Streptococcus.
Sequence
MKVYDSKEMVWTREPKSFSISNQEIVIETQPHTDLWQRTYYHFQNDNAPLLQMTIEDDYF
SFVVKTTFNSKHRFDQCGLVMYLDSENWLKASIEYENEDFQHLGSVVTNQGYSDWATTEI
DASIKEMWYRLSRRGNDFRLECSQDGQTFKQMRICHMAKATGPIQCGIYACSPEDSSFTA
RFTDLQVLECQWPSHDGQAPDEVVSSITNL
Download sequence
Identical sequences B9DV03
gi|222153467|ref|YP_002562644.1| WP_015911666.1.51754 218495.SUB1344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]