SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9FXF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9FXF9
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.94e-31
Family PAPS reductase-like 0.0038
Further Details:      
 
Domain Number 2 Region: 221-295
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000767
Family PDI-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9FXF9
Sequence length 297
Comment (tr|B9FXF9|B9FXF9_ORYSJ) Uncharacterized protein {ECO:0000313|EMBL:EEE67246.1} OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_24397 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MASLDTGRLNPETYQLFDKVEKHYGIRIEYMFPDAGEVQALVRAKGLFSFYEDGHQECCR
ARKVRPLRRALRGLRAWITGQRKDQSPGTRAAIPVVQVDPSFEGLAGGAGSLVKWNPVAN
VDGKDFWTFLRAMDVPVNALHAQGYVSIGVRAVHQARASGQHEREGRWWWEDAKAKECGL
HKGNIDDQGGAAAAAAHKAGGANGNGSAGAPDIFESSGVAMEASYLELAERLGGAGGGVK
VGKFRADGEQKAFAQQELQLQSFPTILLFPSRTARPIKYPSEKRDVDSLLAFVNSLR
Download sequence
Identical sequences B9FXF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]