SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9HK60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9HK60
Domain Number 1 Region: 167-285,385-503,860-1074
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.09e-117
Family Calcium ATPase, transmembrane domain M 0.00086
Further Details:      
 
Domain Number 2 Region: 507-527,658-915
Classification Level Classification E-value
Superfamily HAD-like 3.38e-49
Family Meta-cation ATPase, catalytic domain P 0.0004
Further Details:      
 
Domain Number 3 Region: 516-713
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.63e-36
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0052
Further Details:      
 
Domain Number 4 Region: 287-382
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.28e-24
Family Calcium ATPase, transduction domain A 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9HK60
Sequence length 1106
Comment (tr|B9HK60|B9HK60_POPTR) Calcium-transporting ATPase {ECO:0000256|RuleBase:RU361146} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0008s00850g OC=Populus.
Sequence
MKRIEEEEAKSKEERMATRSSCSSNGLLPSSASPRKTDDLEVGQPIKEFELDDDDDDDPF
DIAHTKNAPLEILRRWRQAALVLNASRRFRYTLDLKKEEEREQRRRMVRSHAQVIRAALL
FRLAGEQQIVLGTSATPPTVTGDYAIGLEELASMTRDHNIFSLHQCGGVKGLSNMLKTNL
ATGIVGDENDLIKRMNTFGTNRYPQKKGRGFLTFLWEAWQDLTLIILIVAAIASLGLGIK
TEGLSHGWYDGASISFAVMLVIIVTAVSDYRQSLQFQNLNKEKQNIQLEVMRGGRIMKIS
IFDIVVGDVVPLRIGDQVPADGILITGHSLAIDESSMTGESKIVHKDQNAPFLMSGCKVA
DGIGTMLVTGVGINTEWGLLMASISEDTGEETPLQVRLNGLATFIGIAGLAVALSVLAVL
LGRYFTGNTKNPDGSVQFIKGETTVSKAVDGVIKILTIAVTIVVVAVPEGLPLAVTLTLA
YSMRKMMADKALVRRLSACETMGSSTTICSDKTGTLTLNQMTVVEAYVGNQKINPPDDPS
QLQSEAGLLLCEGIAQNTTGNVFVPKDGGDVEITGSPTEKAILSWAVKLGMKFDVLRAES
KILRVFPFNSEKKRGGVAIQTADSKVHIHWKGAAEMVLASCTGYLDSNGSLQSIDKEMDF
FKVAIDDMAACSLRCVAIAYRPYELDKVPTDEESLGKWVLPEDELVLLAIVGIKDPCRPG
VKDAVRICTAAGVKVRMVTGDNIQTAKAIALECGILSSGADATEPNIIEGKVFRAYSEKE
REIIAKKITVMGRSSPNDKLLLVQALRKGGEVVAVTGDGTNDAPALHEADIGLSMGIQGT
SDIVILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVGALVINVVAAVSSGDVPLNTV
QLLWVNLIMDTLGALALATEPPTDHLMHRTPVGRREPLITNIMWRNLLIQALYQVAVLLV
LNFRGLSILHLNQDDRKHATIAKNTVIFNAFVLCQVFNEFNARKPDEINVFKGVTKNHLF
MGIVGFTVILQIILIEFTGDFTTTVRLNWKQWLICVAIGIVSWPLAAVGKLIPVPKTPLS
VYFRKPFRRFRTARNALMPQWGLSLN
Download sequence
Identical sequences B9HK60
XP_002310944.2.11743 POPTR_0008s00850.1|PACid:18247948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]