SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9HKP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9HKP0
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily SNARE-like 4.88e-24
Family Synatpobrevin N-terminal domain 0.0089
Further Details:      
 
Domain Number 2 Region: 144-210
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.24e-23
Family SNARE fusion complex 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9HKP0
Sequence length 238
Comment (tr|B9HKP0|B9HKP0_POPTR) Vesicle-associated membrane protein 727 {ECO:0000313|EMBL:EEE88373.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0008s02030g OC=Populus.
Sequence
MSSQRGLIYSFVAKGNVVLAEHTSYSGNFSTVAVQCLQKLPSNSSKYTYSCDGHTFNFLI
DNGFVFLAVADESAGRGLPFVFLERVKDDFKQRYSASIKNEAHPLADDDDDDDLFEDRFS
VAYNLDREFGPRLKEHMQYCLNHPEEISKLSKLKAQITEVKGIMMDNIEKVLDRGERIEL
LVDKTENLQFQADSFQRQGRQLRRKMWLQNLQMKLMVGGGVLVVILILWFVACGGFKC
Download sequence
Identical sequences B9HKP0
POPTR_0008s02030.1|PACid:18248266 XP_002311006.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]