SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9M4S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9M4S0
Domain Number 1 Region: 26-284
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.35e-47
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9M4S0
Sequence length 288
Comment (tr|B9M4S0|B9M4S0_GEODF) Hydrolase or acyltransferase, alpha/beta fold family {ECO:0000313|EMBL:ACM21604.1} KW=Complete proteome; Reference proteome OX=316067 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32). GN=Geob_3261 OC=Geobacteraceae; Geobacter.
Sequence
MTKILLLVLLIALTVLCQGCVGRLFYYPDKETYDTPARHGLPFEEVTFASKDGTRLSGWF
IPAVGKPKGTVIHFHGNAQNMTAHFGFVSWLPAEGFNLFVFDYRGYGKSAGRPNRQGVFE
DSVAAISYIAARKDVDQNRLLILGQSLGGTNAIAAVGMNRFTGIRAVAIESTFASYREIV
RDKIGEIPIVSLFKWPLSYLLVGNSHSADQVVDKIAPLPLLLIYGDEDPIIPYRHGKKLF
EKAKEPKQFWTIKGGSHTEAFLEAGSPYRAKLVSFFLESLDGKLKIPK
Download sequence
Identical sequences B9M4S0
WP_012648332.1.88144 gi|222056343|ref|YP_002538705.1| 316067.Geob_3261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]