SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9MI04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9MI04
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.69e-38
Family RNA methyltransferase FtsJ 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9MI04
Sequence length 220
Comment (tr|B9MI04|B9MI04_ACIET) rRNA (uridine-2'-O-)-methyltransferase {ECO:0000256|HAMAP-Rule:MF_01547} KW=Complete proteome OX=535289 OS=Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY)). GN=Dtpsy_1474 OC=Comamonadaceae; Acidovorax.
Sequence
MKAQTKSKKVNKAWLHDHVNDTYVKLAQKEGYRARAAYKLKEIDEQLGLIKPGHVVVDLG
SSPGAWSQYVRRRLSPDGAAVGQLNGVIIALDILPMEPIEGVTFLQGDFREEEVLARLQE
AVQGRPVDVVVSDMAPNLSGVESVDAVRIAHLIELAVDFAVHHLKPEGALVVKLFHGSGY
SQLVQLFKDTFRVVKPMKPKASRDKSSETFLVGMGLKRQG
Download sequence
Identical sequences B9MI04
gi|222110672|ref|YP_002552936.1| WP_015913064.1.47842 535289.Dtpsy_1474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]