SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9PL60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9PL60
Domain Number 1 Region: 242-337
Classification Level Classification E-value
Superfamily PH domain-like 0.0000287
Family Ran-binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9PL60
Sequence length 408
Comment (tr|B9PL60|B9PL60_TOXGV) Uncharacterized protein {ECO:0000313|EMBL:ESS32178.1} KW=Complete proteome; Reference proteome OX=432359 OS=Toxoplasma gondii (strain ATCC 50861 / VEG). GN=BN1205_076390 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MTDNAQTTSAEAGAANPSGEHPSAGAKRRQTLAAHELRDIQDGKAMDDVDQDSQPADDMK
QADAATLQKRQRLRIVRSAAAVPHPQGETTPGSPVTGSLSPAEKPVEAPKPSAEESASRE
TKDEQNAEGGKATNGVPENGKEGAGKSEKEQVGSSELLLGPAEIKSVQTFSSAFASLSKQ
PQSSFFLSPPQSNAGGETSGTPSLFASLASTSSLFSTSSVNKDNEDGADAEDEQKAEEPS
VIENEVDADEEILFTDRDCRMQRFDASQTAWAPKPPLEGRVQVSASKKPEDNGATRILFF
VHRTGRLQLNTPLFASANYQHPPDRSRQRAVPPRDEKPDDEKNGEEPLTEEMPKKRNTAQ
FLGLRTDAQSSSDTTIYRIRFSNEEKCAEFLSLANERKTKGKSQSTSA
Download sequence
Identical sequences A0A086QL37 A0A125YG76 A0A125YG77 B9PL60
gi|211962705|gb|EEA97900.1| gi|237831487|ref|XP_002365041.1| gb|TGVEG_076390 XP_002365041.1.89292 gb|TGME49_058170 gb|TGGT1_012040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]