SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9PSB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9PSB7
Domain Number 1 Region: 189-237
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000132
Family Tudor domain 0.0091
Further Details:      
 
Weak hits

Sequence:  B9PSB7
Domain Number - Region: 130-174
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00577
Family Chromo domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9PSB7
Sequence length 370
Comment (tr|B9PSB7|B9PSB7_TOXGV) Survival of motor neuron-related-splicing factor 30 {ECO:0000313|EMBL:CEL72913.1} KW=Complete proteome; Reference proteome OX=432359 OS=Toxoplasma gondii (strain ATCC 50861 / VEG). GN=BN1205_033670 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MAELEDTIEDLQAKLQQYEEQLEQVNEALKLQPEESDLLKLKSDLEEVISLTKDLISFQA
QTQTEAEKLDLVVQPSEAPREVSQKEEKEAEERPEKEKLHADASEEKQGSAEISEGGPRL
THLSSGSSVVGRTCLAEYEGKKFYAEILDLKKSKQGERVLVEFIGWKNQQEYPVHQVQLL
APVPPSAIPPGAAAQAIYSEDGKWYDCVIDEHTAGGYKVTYTEYGNTEEVKFDQVRLKKP
KNDAPKRRVKEIITPGGYRIPQYLATKPTDTEAQKSSKKRRVKAIKAQQQLEMAEKDADE
RAKAWQKFNKRAINKRMAGYMSGRGHESMFSGHEVKTTVSISVLSSQRTTVNSFVPRRKH
DVDEELITDD
Download sequence
Identical sequences A0A086K6Y1 A0A086KK01 A0A086LDW3 A0A086Q772 A0A125YY59 A0A125YY60 A0A139XYE1 A0A2G8XYQ8 B9PSB7
gb|TGME49_086440 XP_002369270.1.89292 gb|TGVEG_033670 gb|TGGT1_037860 gi|211966934|gb|EEB02130.1| gi|237839945|ref|XP_002369270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]