SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9T977 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9T977
Domain Number 1 Region: 133-332
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.85e-29
Family HyaE-like 0.079
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.67e-16
Family GntR ligand-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9T977
Sequence length 537
Comment (tr|B9T977|B9T977_RICCO) Uncharacterized protein {ECO:0000313|EMBL:EEF27590.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_0055400 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MTPRRLKPIQAAVERMRYEGAPTSDTVNADLDFHRAVAVASGNDYLAAMIRIVLEPMRPL
IAANFARQGPMFGKIPNTARAEHETLIQAFIDKDAAAARELMGRHISARASAMRRRLIRA
VHRAAPDQMRMGQRMKLIFVGDPMCSWCYGFGKEMSAIAQSMPDLDVQVVVGGMAAGSTQ
VLDDAAKQFRLTHWARVEQMSGAEFNREALMARKDFVYDTEPVCRAVVAARMVAPGVDLL
KVFRAFQRAFYVDGLDTTDGDVLAEIGAKAIAEQDIAVTADAFFEVFSSDEAIDAAQQDF
ALTRRLGVQGFPSLFVEVDGKIGRLTSGYATAGQHVEPRQQRHDGKQRRRRNGGACRCLL
DVVLDRKHVGALGRRHGGADHCREGRRSVQSDRYAQAIHDERHRNQLECREQRVAARMAA
QFVDRQVEADGEQRARRQRFTEDAEVGDGGRGQRQPADRPQQAEDRRENHRVRTDLLGER
AAAHLVRTALLIDFEQHDEGGKHDCAHKHRRDGCGEHAVLTLQRSENGQRDEARVGH
Download sequence
Identical sequences B9T977
27659.m000074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]