SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9TB19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9TB19
Domain Number - Region: 8-71
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0523
Family MesJ substrate recognition domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9TB19
Sequence length 100
Comment (tr|B9TB19|B9TB19_RICCO) Uncharacterized protein {ECO:0000313|EMBL:EEF26945.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_2010040 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MIGFDLGVLPAEVDLLESYLNRANQDPEWVQYVRTTLQNTPPPYFDRAFRSFLEIEMCSL
TKEQIERVSDRATPLSGVLPTAFAGNYGATAAGSAVSGNA
Download sequence
Identical sequences B9TB19
42488.m000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]