SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9TGF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9TGF1
Domain Number 1 Region: 12-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.72e-16
Family GntR-like transcriptional regulators 0.036
Further Details:      
 
Domain Number 2 Region: 87-143
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000968
Family GntR ligand-binding domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9TGF1
Sequence length 143
Comment (tr|B9TGF1|B9TGF1_RICCO) Uncharacterized protein {ECO:0000313|EMBL:EEF25065.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_1800300 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MRDNAIPFVGHERSRNLGDQVADSIVDAAIHGHLVQGQRLIESELADAFGVSRVPVRGAL
HTLAGEGIVISFPNREVRLVTITAEMLEQMLSVRLVLETHAADLAFSAIKKTPKLLTAFE
DAVDDMQRAFRKGSAFLAAQADM
Download sequence
Identical sequences B9TGF1
30756.m000040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]