SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9TNE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9TNE5
Domain Number 1 Region: 106-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000682
Family DsbC/DsbG C-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 32-91
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.000000000471
Family DsbC/DsbG N-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9TNE5
Sequence length 166
Comment (tr|B9TNE5|B9TNE5_RICCO) Thiol:disulfide interchange protein dsbC, putative {ECO:0000313|EMBL:EEF22618.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_1960610 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MPRRFLKRLSVAAALVGAMCSGLAVAADAPEAVIKTTLEAARPDAKVQSVVRSEMPGLYT
VKFVNGPQVYATPDGKYFVLGDLYQVEQKGFVNLAEQKRNGERAKLLADLKPEDMIIFKP
KGETKAAITVFTDVDCGYCRKLHKEVPQLNAMGIEVRYLAYPRAGI
Download sequence
Identical sequences B9TNE5
36246.m000021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]