SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9WG68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9WG68
Domain Number 1 Region: 124-144,192-296
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000738
Family UAS domain 0.034
Further Details:      
 
Domain Number 2 Region: 422-469,506-523
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000019
Family UBX domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9WG68
Sequence length 552
Comment (tr|B9WG68|B9WG68_CANDC) UBX domain-containing protein, putative {ECO:0000313|EMBL:CAX42238.1} KW=Complete proteome OX=573826 OS=3949 / NRRL Y-17841) (Yeast). GN=CD36_43640 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSSSISDWIGSFFQPSTTYQRVGNNSNTNIPGSFPTEESNSPLPSSRINSVFNSQTINST
FRNLSSWLNYLLIQPLIIIILIIFRILSTIINVIYFQNQSTSIVNGSGSRDSITNNNNSR
YEIVDPVAKASKFIRDLEDNLQPPSILQGNNTNGGSGGNVVNDTHSPVTSATGTATATAT
ATATTISASERLPPFFQGSYTQALYMATKRGKFLFVYLTNPHNENANGIFNNIITNEMFL
KIFQTNENIIIWGGDLTNPEAYQLANSLAVTKFPFLGLLCLTRSSKMTPEGPRKTASKLS
LVSKIQGNIINNHNSRQFQTQNGNVDDGDGDDDNNNFVSVANELIKKKFLTKITKYSPEL
NLIRQELQDKYMSQILLKQQELNYQKSLQADKLKKQQKQYDTLSKQYLIYQLDRFEKYLT
KDQTSNDGNNIARIAIKLTNGTRVTGYFPSDNSIEDIFIFVELINRGYLNPISTSTTTTT
TTPHHSVISTLTESQALIKFKNFKLIYKFKLLSPLPPKICLNDELSKDIIMKINQFDIIY
PNGLLIVEDIQN
Download sequence
Identical sequences B9WG68
573826.CD36_43640 XP_002420022.1.45354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]