SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9XKV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9XKV2
Domain Number 1 Region: 78-328
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000535
Family Atu1826-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9XKV2
Sequence length 340
Comment (tr|B9XKV2|B9XKV2_PEDPL) Uncharacterized protein {ECO:0000313|EMBL:EEF59595.1} KW=Complete proteome; Reference proteome OX=320771 OS=Pedosphaera parvula (strain Ellin514). GN=Cflav_PD2502 OC=Verrucomicrobia subdivision 3; Pedosphaera.
Sequence
MLPPQNMIAPLAKFIDWSVLQTGSAMFPKSLREPGPGLKLEEAVRFLKGPDFIPAESPPA
KVQFDDALHFRFPTPRPSKFPENNVVYGRLYRCGERWRERPAIILLHGGVDPIHYRFGFP
LIARQCNRAGFNAATLESPYHYQRRPRQYSTLGVLGPYIPLTPDYFQMAETYAQAVSEIR
GLTSWLLAEGCPAVALAGVSLGGWMAGITVCRDARLAAVVVALAPARQGNILSQLEHVAG
RRARELLLSRRAACEELVRTLLNPGTSRPAISREKLLLIEGIHDLLVSIGPEEIWQSWGQ
PEIWRLPHGHISTFFMPGLAGRIIGWLAPRLEKSALSAPR
Download sequence
Identical sequences B9XKV2
WP_007416438.1.69612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]