SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0H5H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0H5H2
Domain Number - Region: 230-293
Classification Level Classification E-value
Superfamily RING/U-box 0.000193
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number - Region: 279-321
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00051
Family Rad50 coiled-coil Zn hook 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0H5H2
Sequence length 336
Comment (tr|C0H5H2|C0H5H2_PLAF7) Uncharacterized protein {ECO:0000313|EMBL:CAX64350.1} KW=Complete proteome; Reference proteome OX=36329 OS=Plasmodium falciparum (isolate 3D7). GN=PF3D7_1345000 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEHSENIKKRYVNHSDMKLEKFKKAAYEVIEYKEKIIRMLCAILEVQGITTVNIKEYISS
SNEPSLDSFLDNNQYESKGYKKKTSSRKRTLINVPDFRTLKKNKELNLFSNPDKMNEELI
KEKNFSDSVLSSYRMSLDHKKLQNKMIDNMLFRDISGGKKRTFVEEVEDNEEKNNKSAQK
CIDGNDKNFIESRKKALENFQQNENNYDCTYKTIKKKNISGCNTTTKLKDVNSSEECQLC
LMPNSDSLHGNFPPTFYKLTCDHIFHLMCLYETVIRRECRKTCCICHNELSENDKNEIIN
KVKLEKKENEKKSKLLFKVMKLQAENKDYPRKDICS
Download sequence
Identical sequences A0A2I0BWF9 C0H5H2 W4IBR6 W7FJ04
XP_002809069.1.26446 gi|225632013|emb|CAX64350.1| gi|296005498|ref|XP_002809069.1| MAL13P1.224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]