SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0LNH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0LNH8
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.63e-33
Family Duffy binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0LNH8
Sequence length 137
Comment (tr|C0LNH8|C0LNH8_PLAFA) EMP1 {ECO:0000313|EMBL:ACN65111.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var-425 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
ARSFADIGDIVRGKDLFRGYNEKDRKEKQKLQDSLKNIFGKIYNELTNGRNGVKEHYKDE
DDNEGNYFQLREDWWALNRKEVWKAIICSAPEDAKYFREKNSNGNTCTVNKCKCANGDPP
TNLDYVPQYLRWFDEWA
Download sequence
Identical sequences C0LNH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]