SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0QT52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0QT52
Domain Number 1 Region: 353-506
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.83e-31
Family HD domain 0.033
Further Details:      
 
Domain Number 2 Region: 238-336
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.42e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0QT52
Sequence length 553
Comment (tr|C0QT52|C0QT52_PERMH) Ribonuclease Y {ECO:0000256|HAMAP-Rule:MF_00335, ECO:0000256|SAAS:SAAS00548727} KW=Complete proteome; Reference proteome OX=123214 OS=Persephonella marina (strain DSM 14350 / EX-H1). GN=PERMA_0069 OC=Bacteria; Aquificae; Aquificales; Hydrogenothermaceae; Persephonella.
Sequence
MVEIVVGISALAVGTAAGFAACKATVGKTLKEKERKAEEIIKNKEEIEREARRKAEEIIK
EFEAEAKRKAEEIVREAESLKQQQEIIIEKEILKRKQELEKELKSEREELQNLEKTLMSR
EAQLEKRLARLEHREEELDKKWDEIKKLEEEIRSIQKEIEEKEAKLKAAEEQYMLELQRI
ASMTKEEAREELLRKVEEEAKLEAAKLMKEIEEEARKEAEKEAKWNLVTAIQRLAPEITT
SHTISVVDLPSNDLKGRIIGREGRNIRAFEMETGVDLIIDDTPDIVTISSFDPLRREIAK
RSLERLIADGRIHPGRIEEIVTKVKDEMESHIRKLGEETCLELGFTDVHPELFYYIGKLY
YRTSYTQNVLLHTKEVAHLAGIMAAELGLDEKAAKRGGLMHDVGKSISHEVGGSHSKVGA
ELAKRYGEPDVVINAILYHHNDEPARYPEAVLVAAADALSAARPGARREALQSYINRLEK
IEAIVNSFENVEKSFAIQAGREVRIIVNAEKLSDEEAYMLTKEIAKRIEKEVEFPGQIKI
TTIRESRFIEVAK
Download sequence
Identical sequences C0QT52
gi|225849633|ref|YP_002729867.1| WP_012675875.1.53201 123214.PERMA_0069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]