SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0SE86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0SE86
Domain Number 1 Region: 423-539
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-16
Family UBX domain 0.018
Further Details:      
 
Domain Number 2 Region: 200-347
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000186
Family UAS domain 0.062
Further Details:      
 
Weak hits

Sequence:  C0SE86
Domain Number - Region: 12-46
Classification Level Classification E-value
Superfamily UBA-like 0.00316
Family TAP-C domain-like 0.027
Further Details:      
 
Domain Number - Region: 311-421
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0222
Family Outer membrane efflux proteins (OEP) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0SE86
Sequence length 558
Comment (tr|C0SE86|C0SE86_PARBP) Uncharacterized protein {ECO:0000313|EMBL:EEH15904.1} KW=Complete proteome OX=482561 OS=Paracoccidioides brasiliensis (strain Pb03). GN=PABG_05991 OC=Paracoccidioides.
Sequence
MSTEAIDISQLSPSQQTTLQTYIAVTGQDESAAVPLLQRSEWNVQVIMFLGPVSKIQSGN
AACQRFLFQIAITKFFDGEVPDPVAEAQAAMDTPPVYPSRITRNLMNGDDDDIPLSSYYA
RRTAELAPRITSQPVDQPVYRPPFLPAILFTPLSLLYKLLISSFRLFGALFPFLPRLLSN
FAAAGVQGARRDTSGRRPLGPKDSALRFIREFEEEYGSHAVPFLENGYNMALEKAHQELK
YLLVILLSPEHDDTSSWIRDTILSKEVVDFINDSSNQILVWAGNVRDSEAYQVASGLRCT
KFPFFGLIVHNPNVSATAMSVVAKASGFTTPSELIEKLRSAITQSQAPLDRVRATRAEQR
ASRTIRQEQDSAYERSLAQDRERARQRRAAEEARQREENEARERRAAAEKLARYLEQWKR
WRVQSLPHEPPATDKQAVRLSIRLASGDRVIRRFSGSADIEELYAFVECYDILHADGDGS
ESSSSGASQPPPDGFEHKYGFRLVSPMPRVVYEVNAGGSVGEKIGRGGTLLVETIDDDDD
GDGEDDGDDSDPDGAQSS
Download sequence
Identical sequences C0SE86
PABG_05991T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]