SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0Z8C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0Z8C4
Domain Number - Region: 33-132
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00131
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0Z8C4
Sequence length 145
Comment (tr|C0Z8C4|C0Z8C4_BREBN) Uncharacterized protein {ECO:0000313|EMBL:BAH46551.1} KW=Complete proteome; Reference proteome OX=358681 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599). GN=BBR47_55740 OC=Brevibacillus.
Sequence
MKHSFKRILSSCMVLAALAMGTQSAFASDGYGDTQDKAVPIKIYKPMSHTISDSNDVDWY
EYDNRSGQSISVLLESPQNQNYDFDLVYISANGKVHETYKPNDFGPGGSDVLGLQIGLGD
QVYIKVYGHSASDFDKNNPYKLTIN
Download sequence
Identical sequences C0Z8C4
gi|226315159|ref|YP_002775055.1| WP_015893742.1.45054 358681.BBR47_55740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]