SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0Z950 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0Z950
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.02e-54
Family Haloperoxidase 0.0000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0Z950
Sequence length 269
Comment (tr|C0Z950|C0Z950_BREBN) Uncharacterized protein {ECO:0000313|EMBL:BAH42520.1} KW=Complete proteome; Reference proteome OX=358681 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599). GN=BBR47_15430 OC=Brevibacillus.
Sequence
MYIEVEKGVTVFVEDLNPGPNSKTIFFVHGWPLNHNMFSYQFNVLPQHGFRCVAMDIRGN
GQSDKPWSGYTYDRLADDIFVVLEALQIRDAVLLGFSVGGAISIRYMSRYEGRHISKLAL
VDAVSPSFVKMPGSPYGVSKEQADGLISQMYANLPELLNTVSLQFFNRNLGTAMLQWFVK
MGLDSASYALIKIMQAAVKENVINDLGQIRVPTGIFHGIHDQLIPFKSAELTQQQIKGSK
LFSFDNSGHGLPICQADDFNKKLMAFVQS
Download sequence
Identical sequences C0Z950
gi|226311130|ref|YP_002771024.1| WP_012685269.1.45054 358681.BBR47_15430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]